PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0003s1010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 696aa    MW: 77120 Da    PI: 6.2517
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0003s1010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.11.5e-22124223197
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF
  SapurV1A.0003s1010.1.p 124 FCKILTASDTSTHGGFSVLRKHATEClppldMSQATPTQELAARDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVF 210
                             99****************************9555566679*********************************************** PP

                             EE-SSSEE..EEEEE CS
                      B3  83 kldgrsefelvvkvf 97 
                                + +++el+v+v+
  SapurV1A.0003s1010.1.p 211 L--RGDNGELRVGVR 223
                             *..348888999986 PP

2Auxin_resp93.82.8e-31250329183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+ t++ F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vg+ d++p +W++S WrsLk
  SapurV1A.0003s1010.1.p 250 ASHAVLTQTLFVVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTGTIVGIGDISP-EWSGSIWRSLK 329
                             68999*************6..99**********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-40115253IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-39118239IPR015300DNA-binding pseudobarrel domain
CDDcd100172.24E-19122224No hitNo description
PfamPF023621.3E-20124223IPR003340B3 DNA binding domain
SMARTSM010198.3E-20124226IPR003340B3 DNA binding domain
PROSITE profilePS5086311.434124226IPR003340B3 DNA binding domain
PfamPF065071.6E-29250329IPR010525Auxin response factor
PfamPF023096.5E-7559616IPR033389AUX/IAA domain
SuperFamilySSF542772.21E-11575656No hitNo description
PROSITE profilePS5174525.528580661IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MSSQGESSSS FRGLGCDDLY TELWKACAGP LVDVPKAGER VFYFPQGHME QLEASTNQEL  60
NQQIPRFNLP PKILCRVINI QLLAEQDTDE VYAQIALHPE ADQTEPTSPD PCPPEPEKQT  120
IHSFCKILTA SDTSTHGGFS VLRKHATECL PPLDMSQATP TQELAARDLH GFEWRFKHIF  180
RGQPRRHLLT TGWSTFVTSK RLVAGDAFVF LRGDNGELRV GVRCLARQQS SIPSSVISSQ  240
SMHLGVLATA SHAVLTQTLF VVYYKPRTNQ YIIGLNKYLE AVKNGFSVGM RFKMRFEGED  300
SPERRFTGTI VGIGDISPEW SGSIWRSLKI QWDEPATIQR PERVSPWDIE PFAAPASPNL  360
TQQVVKNKRP RPTDIPTSVI ALNSAASSFW YHGSTQSHEL AQLGCSTEVQ SSESHVWSMR  420
QKEIDSNLLN NSSSCNTRAR PEGMWPSSPH MNVSLNFFPD SAGDNDFATT RSIISGFSSP  480
MSSRQSNCLI SEQVEKGRKY ENSAGCRLFG IDLTSNSGSS APPEKEPAYP ITKVLVPAAS  540
EAERAQTMDV SMYSKEQKQV LSEALLKESR SKQGSATSTR TCTKVQMQGI AVGRALDLTA  600
LKGYMDLINE LEKMFEIEGE LSTPKKWAVV FTDDEGDMML LGDDPWLEFC KMVKKIFIYS  660
SDEVKKTGTR CKLSASSFEG EGTVVSMDSE HRSDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17613521355Auxin response factor 1
4ldw_A1e-17613521355Auxin response factor 1
4ldw_B1e-17613521355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1367371KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386630.10.0hypothetical protein POPTR_0002s17350g
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLU5GT510.0U5GT51_POPTR; Auxin response factor
STRINGPOPTR_0002s17350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9